PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G337800.1.p
Common NameSb02g036250, SORBIDRAFT_02g036250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 375aa    MW: 40611.7 Da    PI: 7.2894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G337800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.7e-191461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEde+l+ ++k++G g+W+t ++  g+ R++k+c++rw +yl
  Sobic.002G337800.1.p 14 KGPWTPEEDEKLIAYIKKHGQGNWRTLPKNAGLARCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Sobic.002G337800.1.p  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.728965IPR017930Myb domain
SuperFamilySSF466898.99E-3211108IPR009057Homeodomain-like
SMARTSM007171.1E-151363IPR001005SANT/Myb domain
PfamPF002494.0E-171461IPR001005SANT/Myb domain
CDDcd001671.14E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.4666116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
CDDcd001672.76E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGRAPCCEKS GMKKGPWTPE EDEKLIAYIK KHGQGNWRTL PKNAGLARCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLSALLK PAAAAYYPTQ ADLDTLRALE PLANYPDLLR LASTLLSSGP  180
PAIGDHHQNG QLLPWILQAQ MAQQAAAAMA QQVAPPPQQQ AEQFMQAGAA CQMPDLVHMN  240
SNPTTVQQQL AAAHQDMAAA ACHSMQPPNN TGYEVDSLDV PALMQMVQAA DASNLQQWSS  300
TVTSSSNNNN NNNNNVGSGV STPSSSPVAR LNHSTSTTTT TYGGASASTS NDAAAAAALF  360
NMQLSELLDV SDYM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2485790.0AK248579.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97l09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463015.10.0hypothetical protein SORBIDRAFT_02g036250
TrEMBLC5XBI70.0C5XBI7_SORBI; Putative uncharacterized protein Sb02g036250
STRINGSb02g036250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-84MYB-like 102